PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0119s0060.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family TALE
Protein Properties Length: 665aa    MW: 74544.6 Da    PI: 6.816
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0119s0060.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox26.98.4e-094294661954
                             HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
                Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                             Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  SapurV1A.0119s0060.2.p 429 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 466
                             554458******************************88 PP

2BELL114.26.9e-37291361272
                    BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                             + elqk+k+k+ls+leeVd+rY++y++q+++++ssFeavag g+a +Y +lA+ka+SrhFrcL+d i++qi
  SapurV1A.0119s0060.2.p 291 FIELQKRKTKMLSMLEEVDRRYRHYCDQMKAMVSSFEAVAGAGAASVYSALASKAMSRHFRCLRDGIVDQI 361
                             689*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.5E-57229359IPR006563POX domain
PfamPF075262.2E-45235357IPR006563POX domain
PROSITE profilePS5007112.034407470IPR001356Homeobox domain
SMARTSM003891.1E-8410474IPR001356Homeobox domain
CDDcd000865.07E-11410471No hitNo description
SuperFamilySSF466891.03E-16411476IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.6E-27413476IPR009057Homeodomain-like
PfamPF059208.9E-18427466IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 665 aa     Download sequence    Send to blast
MAREPCEDKS RNMVSSGSFC YPDVSSCNPT IQTHLVNQIQ GYESNPEIFN LTTGMEMIGF  60
SKNLQHHQSD SNSVMWKGFF NKAANNHHPG GPSSSKTIHE STNGDFYQHE YNKPDFSTGI  120
SEASNENLMI GSDHSAPWQE NRLLVDDSSL RCVFPCEGNE RPSQGLSLSL SSSNPSSIGL  180
HSFELRHNPT HQNQDNSQEE MRFFGKSPAN IQQQMVQDGF LTKAANLHHQ AQFQLRNSKY  240
LGPAQDLLKE FCNLGTKQVD ALQKKSHKPK QWDDDQTGSS SRKQSLQSLE FIELQKRKTK  300
MLSMLEEVDR RYRHYCDQMK AMVSSFEAVA GAGAASVYSA LASKAMSRHF RCLRDGIVDQ  360
IHATKKAMGE KDPVAPGTTK GETPRLKILD QALRQQRAFQ QMSMMESHPW RPQRGLPERS  420
VSFLRAWLFE HFLHPYPSDV DKHILARQTG LSRSQVSNWF INARVRLWKP MVEEMYLEET  480
KEQGNNMASS DGVTDLDENI NGRPNQNPSS TDQKPTPDQL NRIDSECLSS VISNPDKNDT  540
NKSTISFQSH HLQHQQHNFG NYGGMDLDFS SYNHHTAGGV SYANDNASNQ NFNGGGVSLT  600
LGLQQHKGSG VSLAFSPASQ SSLFYPRDHI EDGHPVQYSL LDGEGQNLPY RNLMGAQLLH  660
DMDG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-15416474563Homeobox protein Meis2
3k2a_B4e-15416474563Homeobox protein Meis2
4xrm_A5e-15416474563Homeobox protein Meis2
4xrm_B5e-15416474563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT0292921e-114CT029292.1 Poplar cDNA sequences.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006385769.10.0hypothetical protein POPTR_0003s13120g
RefseqXP_006385771.10.0hypothetical protein POPTR_0003s13120g
RefseqXP_006385773.10.0hypothetical protein POPTR_0003s13120g
SwissprotQ388971e-150BEL1_ARATH; Homeobox protein BEL1 homolog
TrEMBLU5GJA20.0U5GJA2_POPTR; Uncharacterized protein
STRINGPOPTR_0003s13120.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41410.11e-136TALE family protein